General Information

  • ID:  hor005923
  • Uniprot ID:  P06298
  • Protein name:  Beta-endorphin
  • Gene name:  pomc-a
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMTPERSQTPLMTLFKNAIIKNSHKKGQ
  • Length:  31(229-259)
  • Propeptide:  MFRPLWGCFLAILGICIFHIGEVQSQCWESSRCADLSSEDGVLECIKACKTDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNSTGNDGSNTGYKREDISSYPVFSLFPLSDQNAPGDNMEEEPLDRQENKRAYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESYPMELRRELSLELDYPEIDLDEDIEDNEVESALTKKNGNYRMHHFRWGSPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNSH
  • Signal peptide:  MFRPLWGCFLAILGICIFHIGEVQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06298-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005923_AF2.pdbhor005923_ESM.pdb

Physical Information

Mass: 405939 Formula: C157H252N44O44S2
Absent amino acids: CDVW Common amino acids: K
pI: 10.86 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -72.26 Boman Index: -5263
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 53.55
Instability Index: 3207.74 Extinction Coefficient cystines: 1490
Absorbance 280nm: 49.67

Literature

  • PubMed ID:  3754961
  • Title:  Expression of two proopiomelanocortin genes in the pituitary gland of Xenopus laevis: complete structures of the two preprohormones.
  • PubMed ID:  1584015
  • Title:  Comparative structural analysis of the transcriptionally active proopiomelanocortin genes A and B of Xenopus laevis.
  • PubMed ID:  3840481
  • Title:  Nuc
  • PubMed ID:  2564347
  • Title: